Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P09211 |
Gene Names | GSTP1 |
Alternative Names | GST class-piGSTP1-1 |
Expression Region | Full Length of Mature Protein(2-210aa ) |
Molecular Weight | 28.2 kDa |
Protein Sequence | PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. |
Involvement in Disease | |
Subcellular Location | Cytoplasm, Mitochondrion, Nucleus |
Protein Families | GST superfamily, Pi family |
Tissue Specificity | GSTP1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |