Recombinant Human Glutathione S-transferase A2(GSTA2)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P09210
Gene Names GSTA2
Alternative Names GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2
Expression Region Full Length of BC002895(1-222aa )
Molecular Weight 52.7 kDa
Protein Sequence MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families GST superfamily, Alpha family
Tissue Specificity GSTA2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE1HU10096

Recombinant Human Glutathione S-transferase A2(GSTA2)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Glutathione S-transferase A2(GSTA2)
Copyright © 2021-present Echo Biosystems. All rights reserved.