Recombinant Human Glutamyl aminopeptidase(ENPEP),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q07075
Gene Names ENPEP
Alternative Names Aminopeptidase A ;AP-ADifferentiation antigen gp160; CD249
Expression Region Extracellular Domain(719-949aa )
Molecular Weight 31 kDa
Protein Sequence YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Appears to have a role in the catabolic pathway of the renin-angiotensin syst. Probably plays a role in regulating growth and differentiation of early B-lineage cells.
Involvement in Disease
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Peptidase M1 family
Tissue Specificity ENPEP
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PRc147719

Recombinant Human Glutamyl aminopeptidase(ENPEP),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Glutamyl aminopeptidase(ENPEP),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.