Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O94925 |
Gene Names | GLS |
Alternative Names | K-glutaminase L-glutamine amidohydrolase |
Expression Region | Partial(616-669aa ) |
Molecular Weight | 33.3 kDa |
Protein Sequence | KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity. |
Involvement in Disease | |
Subcellular Location | Isoform 1: Cytoplasm, cytosol, SUBCELLULAR LOCATION: Isoform 3: Mitochondrion |
Protein Families | Glutaminase family |
Tissue Specificity | GLS |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |