Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P04150 |
| Gene Names | NR3C1 |
| Alternative Names | Nuclear receptor subfamily 3 group C member 1 GRL |
| Expression Region | Partial(521-777aa ) |
| Molecular Weight | 59.8 kDa |
| Protein Sequence | VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth |
| Involvement in Disease | Glucocorticoid resistance, generalized (GCCR) |
| Subcellular Location | Isoform Alpha: Cytoplasm, Nucleus, Mitochondrion, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Note=After ligand activation, translocates from the cytoplasm to the nucleus, SUBCELLULAR LOCATION: Isoform Beta: Nucleus, Cytoplasm, Note=Expressed predominantly in the nucleus with some expression also detected in the cytoplasm, SUBCELLULAR LOCATION: Isoform Alpha-B: Nucleus, Cytoplasm |
| Protein Families | Nuclear hormone receptor family, NR3 subfamily |
| Tissue Specificity | NR3C1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
