Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P60520 |
| Gene Names | GABARAPL2 |
| Alternative Names | GABA(A) receptor-associated protein-like 2Ganglioside expression factor 2 ;GEF-2General protein transport factor p16Golgi-associated ATPase enhancer of 16KDA ;GATE-16MAP1 light chain 3-related protein |
| Expression Region | Full Length(1-117aa ) |
| Molecular Weight | 40.7 kDa |
| Protein Sequence | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 . Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
| Involvement in Disease | |
| Subcellular Location | Golgi apparatus, Cytoplasmic vesicle, autophagosome |
| Protein Families | ATG8 family |
| Tissue Specificity | GABARAPL2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |