Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9H0R8 |
Gene Names | GABARAPL1 |
Alternative Names | Early estrogen-regulated protein GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1 |
Expression Region | Full Length(1-117aa ) |
Molecular Weight | 40.9 kDa |
Protein Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
Involvement in Disease | |
Subcellular Location | Cytoplasm, cytoskeleton, Cytoplasmic vesicle membrane, Lipid-anchor, Endoplasmic reticulum, Golgi apparatus, Cytoplasmic vesicle, autophagosome |
Protein Families | ATG8 family |
Tissue Specificity | GABARAPL1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |