Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O95166 |
| Gene Names | GABARAP |
| Alternative Names | GABA(A) receptor-associated protein;MM46 |
| Expression Region | Partial(2-117aa ) |
| Molecular Weight | 40.8 kDa |
| Protein Sequence | KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
| Involvement in Disease | |
| Subcellular Location | Endomembrane system, Cytoplasm, cytoskeleton, Golgi apparatus membrane, Cytoplasmic vesicle, autophagosome, Cytoplasmic vesicle |
| Protein Families | ATG8 family |
| Tissue Specificity | GABARAP |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |