Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens G antigen 2B (GAGE2B) (NM_001098411). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q13066 |
| Entry Name | GAG2B_HUMAN |
| Gene Names | GAGE2B GAGE2; GAGE2C |
| Alternative Gene Names | GAGE2; |
| Alternative Protein Names | G antigen 2B/2C (GAGE-2B) (GAGE-2C) (Cancer/testis antigen 4.2) (CT4.2) (G antigen 2C) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 116 |
| Molecular Weight(Da) | 12786 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
Background
| Function | FUNCTION: Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes. |
| Pathway | |
| Protein Families | GAGE family |
| Tissue Specificity | Expressed in a variety of tumor tissues but not in normal tissues, except testis. {ECO:0000269|PubMed:7544395}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |