Specification
| Organism | Homo sapiens (Human) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q5UAW9 |
| Gene Names | GPR157 |
| Alternative Names | GPR157G-protein coupled receptor 157 |
| Expression Region | Full Length(1-335aa ) |
| Molecular Weight | 39.4 kDa |
| Protein Sequence | MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Orphan receptor that promotes neuronal differentiation of radial glial progenitors (RGPs). The activity of this receptor is mediated by a G(q)-protein that activates a phosphatidylinositol-calcium second messenger. |
| Involvement in Disease | |
| Subcellular Location | Cell projection, cilium membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 2 family |
| Tissue Specificity | GPR157 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |