Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | O76087 |
| Gene Names | GAGE7 |
| Alternative Names | (GAGE-7)(AL4)(Cancer/testis antigen 4.7)(CT4.7)(GAGE-12I)(GAGE-7B)(GAGE-8) |
| Expression Region | 1-117aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.83 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-175℃. |
| Protein Length | Full Length |
| Molecular Weight | 18.9 kDa |
| Protein Sequence | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
Background
| Research Areas | Others |
| Relevance | |
| Function | |
| Reference | "An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members." Gjerstorff M.F., Ditzel H.J. Tissue Antigens 71:187-192(2008) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |