Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P78423 |
| Gene Names | CX3CL1 |
| Alternative Names | C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin;Small-inducible cytokine D1 |
| Expression Region | Partial(25-100aa ) |
| Molecular Weight | 24.6 kDa |
| Protein Sequence | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed fractalkine: Secreted |
| Protein Families | Intercrine delta family |
| Tissue Specificity | CX3CL1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |