Recombinant Human Formimidoyltransferase-cyclodeaminase(FTCD)

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info C-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O95954
Gene Names FTCD
Alternative Names Formimidoyltransferase-cyclodeaminase(Formiminotransferase-cyclodeaminase)(FTCD)(LCHC1) [Includes: Glutamate formimidoyltransferase(EC 2.1.2.5)(Glutamate formiminotransferase)(Glutamate formyltransferase); Formimidoyltetrahydrofolate cyclodeaminase(EC 4.3.1.4)(Formiminotetrahydrofolate cyclodeaminase)]
Expression Region Full Length(1-541aa )
Molecular Weight 60 kDa
Protein Sequence MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Folate-dependent enzyme, that displays both transferase and deaminase activity. Serves to channel one-carbon units from formiminoglutamate to the folate pool.; Binds and promotes bundling of vimentin filaments originating from the Golgi.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity FTCD
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY9HU9154

Recombinant Human Formimidoyltransferase-cyclodeaminase(FTCD)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Formimidoyltransferase-cyclodeaminase(FTCD)
Copyright © 2021-present Echo Biosystems. All rights reserved.