Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9H334 |
| Gene Names | FOXP1 |
| Alternative Names | Mac-1-regulated forkhead1 |
| Expression Region | Partial(1-114aa ) |
| Molecular Weight | 39.2 kDa |
| Protein Sequence | MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Transcriptional repressor . Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential . Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in bryonic st cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintainance of hair follicle st cell quiescence; the function probably involves regulation of FGF18 . Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis . Binds to CSF1R promoter elents and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes ses to involve NCOR2 as corepressor . Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization ses to implicate suppression of SA5B . Can negatively regulate androgen receptor signaling . |
| Involvement in Disease | Mental retardation with language impairment and autistic features (MRLIAF) |
| Subcellular Location | Nucleus |
| Protein Families | |
| Tissue Specificity | FOXP1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |