Recombinant Human Forkhead box protein M1(FOxM1),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q08050
Gene Names FOXM1
Alternative Names Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11
Expression Region Partial(235-327aa )
Molecular Weight 31.2 kDa
Protein Sequence ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.
Involvement in Disease
Subcellular Location Nucleus
Protein Families
Tissue Specificity FOXM1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$230.00
In stock
SKU
EB-PE8HU8953

Recombinant Human Forkhead box protein M1(FOxM1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Forkhead box protein M1(FOxM1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.