Recombinant Human Follistatin-related protein 1 (FSTL1), partial

Specification
Uniprot ID Q12841
Gene Names FSTL1
Alternative Names (Follistatin-like protein 1)
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-GST-tagged
Molecular Weight 43.8 kDa
Expression Region Partial(176-285aa )
Expression Region N-terminal 6xHis-GST-tagged(Partial )
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Not test.
Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Storage Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Protein Sequence ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR
Background
Research Areas Cardiovascular
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$282.00
In stock
SKU
EB-EHU118397983

Recombinant Human Follistatin-related protein 1 (FSTL1), partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Follistatin-related protein 1 (FSTL1), partial
Copyright © 2021-present Echo Biosystems. All rights reserved.