Recombinant Human FOLH1B protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens folate hydrolase 1B (FOLH1B) (NM_153696).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9HBA9
Entry Name FOH1B_HUMAN
Gene Names FOLH1B PSMAL GIG26
Alternative Gene Names PSMAL
Alternative Protein Names Putative N-acetylated-alpha-linked acidic dipeptidase (NAALADase) (EC 3.4.-.-) (Cell growth-inhibiting gene 26 protein) (Prostate-specific membrane antigen-like protein) (Putative folate hydrolase 1B)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 442
Molecular Weight(Da) 50045
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGGSAPPDSSWRGSLKVSYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHETVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEDNSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYNISMKHPQEMKTYSLSFDSLFSAVKNFTEIASKFSERLQDFDKSNPILLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGDVKRQISVAAFTVQAAAETLSEVA
Background
Function FUNCTION: Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. {ECO:0000250}.; FUNCTION: Exhibits a dipeptidyl-peptidase IV type activity. {ECO:0000250}.
Pathway
Protein Families Peptidase M28 family, M28B subfamily
Tissue Specificity Kidney and liver. Not expressed in the prostate. {ECO:0000269|PubMed:14716746}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8117315

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FOLH1B protein
Copyright © 2021-present Echo Biosystems. All rights reserved.