Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Baculovirus |
| Tag Info | N-terminal 10xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P14207 |
| Gene Names | FOLR2 |
| Alternative Names | Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein |
| Expression Region | Partial(19-230aa ) |
| Molecular Weight | 27.1 kDa |
| Protein Sequence | CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor, Secreted |
| Protein Families | Folate receptor family |
| Tissue Specificity | FOLR2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |