Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P21462 |
Gene Names | FPR1 |
Alternative Names | N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor |
Expression Region | Partial(306-350aa ) |
Molecular Weight | 34.9 kDa |
Protein Sequence | QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system |
Involvement in Disease | |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | G-protein coupled receptor 1 family |
Tissue Specificity | FPR1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |