Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens flotillin 1 (FLOT1), transcript variant 1 (NM_005803). |
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O75955 |
| Entry Name | FLOT1_HUMAN |
| Gene Names | FLOT1 |
| Form | Lyophilized or Liquid |
| Alternative Protein Names | Flotillin-1 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Please contact us for the informtion |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 146 |
| Molecular Weight(Da) | 167KDa |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) QRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR |
Background
| Function | FUNCTION: May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. |
| Pathway | |
| Protein Families | Band 7/mec-2 family, Flotillin subfamily |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |