Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8NAU1 |
| Gene Names | FNDC5 |
| Alternative Names | Fibronectin type III repeat-containing protein 2 |
| Expression Region | Partial(32-143aa ) |
| Molecular Weight | 28.6 kDa |
| Protein Sequence | DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Irisin: Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Peroxisome membrane, Single-pass type I membrane protein, Note=Imported in peroxisomes through the PEX5 receptor pathway, SUBCELLULAR LOCATION: Irisin: Secreted |
| Protein Families | |
| Tissue Specificity | FNDC5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |