Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1(FANK1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q8TC84
Gene Names FANK1
Alternative Names 1700007B22Rik; AI850911; Fank1; FANK1_HUMAN; Fibronectin type 3 and ankyrin repeat domains 1; Fibronectin type 3 and ankyrin repeat domains protein 1; Fibronectin type III and ankyrin repeat domains 1; HSD13
Expression Region Full Length(1-345aa )
Molecular Weight 54.3 kDa
Protein Sequence MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Nucleus, Cytoplasm, cytosol
Protein Families
Tissue Specificity FANK1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE8HU819583

Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1(FANK1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1(FANK1)
Copyright © 2021-present Echo Biosystems. All rights reserved.