Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 95% as determined by SDS-PAGE. |
Uniprot ID | P55075-4 |
Uniprot Entry Name | |
Gene Names | FGF8 |
Alternative Names | Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B |
Expression Region | Partial of Isoform 4 (23-244aa) |
Molecular Weight | 27.7 kDa |
Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
Sequence | QEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR |
Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4) |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Fibroblast growth factor 8 (FGF8) is a member of the fibroblast growth factor family. It is discovered as a growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells. Mouse FGF8b shares 100% aa identity with human FGF8b. FGF8 is widely expressed during embryogenesis, and mediates epithelial-mesenchymal transitions. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. It is required for normal brain, eye, ear, limb development during embryogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. |
Function | |
Involvement in disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | |
Pathway |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |