Recombinant Human Fibroblast growth factor 2(FGF2),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P09038
Uniprot Entry Name
Gene Names FGF2
Alternative Names Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Expression Region Partial (132-288aa)
Molecular Weight 17.4 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5)
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4.
Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis
Involvement in disease
Subcellular Location Secreted, Nucleus
Protein Families Heparin-binding growth factors family
Tissue Specificity Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Pathway MAPKsignalingpathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$86.00
In stock
SKU
EB-CAPHU3876

Recombinant Human Fibroblast growth factor 2(FGF2),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Fibroblast growth factor 2(FGF2),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.