Recombinant Human Fibroblast growth factor 17(FGF17) (Active)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID O60258
Uniprot Entry Name
Gene Names FGF17
Alternative Names Fibroblast Growth Factor 17; FGF-17; FGF17
Expression Region Full Length of Mature Protein (23-216aa)
Molecular Weight 22.6 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4)
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors.
Function Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Involvement in disease Hypogonadotropic hypogonadism 20 with or without anosmia (HH20)
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Tissue Specificity Preferentially expressed in the embryonic brain.
Pathway MAPKsignalingpathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$183.00
In stock
SKU
EB-CAPHU4026

Recombinant Human Fibroblast growth factor 17(FGF17) (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Fibroblast growth factor 17(FGF17) (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.