Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | Tag-Free |
Purity | Greater than 95% as determined by SDS-PAGE. |
Uniprot ID | O60258 |
Uniprot Entry Name | |
Gene Names | FGF17 |
Alternative Names | Fibroblast Growth Factor 17; FGF-17; FGF17 |
Expression Region | Full Length of Mature Protein (23-216aa) |
Molecular Weight | 22.6 kDa |
Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT |
Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors. |
Function | Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. |
Involvement in disease | Hypogonadotropic hypogonadism 20 with or without anosmia (HH20) |
Subcellular Location | Secreted |
Protein Families | Heparin-binding growth factors family |
Tissue Specificity | Preferentially expressed in the embryonic brain. |
Pathway | MAPKsignalingpathway |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |