Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q92915 |
| Gene Names | FGF14 |
| Alternative Names | Fibroblast growth factor homologous factor 4 |
| Expression Region | Full Length of Isoform 2(1-252aa ) |
| Molecular Weight | 55.5 kDa |
| Protein Sequence | MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probably involved in nervous system development and function. |
| Involvement in Disease | Spinocerebellar ataxia 27 (SCA27) |
| Subcellular Location | Nucleus |
| Protein Families | Heparin-binding growth factors family |
| Tissue Specificity | FGF14 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |