Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P61328-2 |
| Uniprot Entry Name | |
| Gene Names | FGF12 |
| Alternative Names | Fibroblast Growth Factor 12; FGF-12; Fibroblast Growth Factor Homologous Factor 1; FHF-1; Myocyte-Activating Factor; FGF12; FGF12B; FHF1 |
| Expression Region | Full Length of Isoform 2 (1-181aa) |
| Molecular Weight | 20.45 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.5) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Function | |
| Involvement in disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |