Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O15520 |
| Gene Names | FGF10 |
| Alternative Names | Keratinocyte growth factor 2 |
| Expression Region | Partial(41-208aa ) |
| Molecular Weight | 35 kDa |
| Protein Sequence | GQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing. |
| Involvement in Disease | Aplasia of lacrimal and salivary glands (ALSG); Lacrimo-auriculo-dento-digital syndrome (LADDS) |
| Subcellular Location | Secreted |
| Protein Families | Heparin-binding growth factors family |
| Tissue Specificity | FGF10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |