Recombinant Human FGL1 Protein

Specification
Description Recombinant protein from the fibrinogen domain (Leu74 - Asp306) of homo sapiens fibrinogen like 1 (FGL1) (NM_201553).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q08830
Entry Name FGL1_HUMAN
Gene Names FGL1 HFREP1
Alternative Gene Names HFREP1
Alternative Protein Names Fibrinogen-like protein 1 (HP-041) (Hepassocin) (HPS) (Hepatocyte-derived fibrinogen-related protein 1) (HFREP-1) (Liver fibrinogen-related protein 1) (LFIRE-1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 312
Molecular Weight(Da) 36379
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Background
Function FUNCTION: Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3 (PubMed:30580966). Responsible for LAG3 T-cell inhibitory function (PubMed:30580966). Binds LAG3 independently from MHC class II (MHC-II) (PubMed:30580966). Secreted by, and promotes growth of, hepatocytes (PubMed:11470158, PubMed:19880967). {ECO:0000269|PubMed:11470158, ECO:0000269|PubMed:19880967, ECO:0000269|PubMed:30580966}.
Pathway
Protein Families
Tissue Specificity Under normal conditions, liver-specific. {ECO:0000269|PubMed:11470158}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE136189

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FGL1 Protein
Copyright © 2021-present Echo Biosystems. All rights reserved.