Recombinant Human FGFBP2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens fibroblast growth factor binding protein 2 (FGFBP2) (NM_031950).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BYJ0
Entry Name FGFP2_HUMAN
Gene Names FGFBP2 KSP37 UNQ425/PRO1065
Alternative Gene Names KSP37
Alternative Protein Names Fibroblast growth factor-binding protein 2 (FGF-BP2) (FGF-binding protein 2) (FGFBP-2) (37 kDa killer-specific secretory protein) (Ksp37) (HBp17-related protein) (HBp17-RP)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 223
Molecular Weight(Da) 24581
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
Background
Function
Pathway
Protein Families Fibroblast growth factor-binding protein family
Tissue Specificity Expressed in serum, peripheral leukocytes and cytotoxic T-lymphocytes, but not in granulocytes and monocytes (at protein level). {ECO:0000269|PubMed:11342666}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8495005

Recombinant Human FGFBP2 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FGFBP2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.