Recombinant Human FGF19 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens fibroblast growth factor 19 (FGF19) (NM_005117).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O95750
Entry Name FGF19_HUMAN
Gene Names FGF19 UNQ334/PRO533
Alternative Gene Names
Alternative Protein Names Fibroblast growth factor 19 (FGF-19)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 216
Molecular Weight(Da) 24003
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Background
Function FUNCTION: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4. {ECO:0000269|PubMed:12815072, ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:17623664, ECO:0000269|PubMed:19085950}.
Pathway
Protein Families Heparin-binding growth factors family
Tissue Specificity Expressed in fetal brain, cartilage, retina, and adult gall bladder. {ECO:0000269|PubMed:10525310}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8435105

Recombinant Human FGF19 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FGF19 protein
Copyright © 2026-present Echo Bio. All rights reserved.