Recombinant Human FAM3C protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens FAM3 metabolism regulating signaling molecule C (FAM3C), transcript variant 1 (NM_014888).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q92520
Entry Name FAM3C_HUMAN
Gene Names FAM3C ILEI GS3786
Alternative Gene Names ILEI
Alternative Protein Names Protein FAM3C (Interleukin-like EMT inducer)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 227
Molecular Weight(Da) 24680
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Background
Function FUNCTION: May be involved in retinal laminar formation. Promotes epithelial to mesenchymal transition.
Pathway
Protein Families FAM3 family
Tissue Specificity Present in most secretory epithelia (at protein level). {ECO:0000269|PubMed:16959614}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8256636

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FAM3C protein
Copyright © 2021-present Echo Biosystems. All rights reserved.