Recombinant Human FAM241B protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens family with sequence similarity 241 member B (FAM241B) (NM_145306).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96D05
Entry Name F241B_HUMAN
Gene Names FAM241B C10orf35
Alternative Gene Names C10orf35
Alternative Protein Names Protein FAM241B
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 121
Molecular Weight(Da) 13238
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR
Background
Function FUNCTION: May play a role in lysosome homeostasis. {ECO:0000269|PubMed:31270356}.
Pathway
Protein Families FAM241 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8018165

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FAM241B protein
Copyright © 2021-present Echo Biosystems. All rights reserved.