Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens family with sequence similarity 107 member A (FAM107A), transcript variant 2 (NM_001076778). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O95990 |
| Entry Name | F107A_HUMAN |
| Gene Names | FAM107A DRR1 TU3A |
| Alternative Gene Names | DRR1 TU3A |
| Alternative Protein Names | Actin-associated protein FAM107A (Down-regulated in renal cell carcinoma 1) (Protein TU3A) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 144 |
| Molecular Weight(Da) | 17455 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL |
Background
| Function | FUNCTION: Stress-inducible actin-binding protein that plays a role in synaptic and cognitive functions by modulating actin filamentous (F-actin) dynamics. Mediates polymerization of globular actin to F-actin. Also binds to, stabilizes and bundles F-actin. Involved in synaptic function by regulating neurite outgrowth in an actin-dependent manner and for the acquisition of hippocampus-dependent cognitive function, such as learning and long-term memory (By similarity). Plays a role in the actin and microtubule cytoskeleton organization; negatively regulates focal adhesion (FA) assembly promoting malignant glial cell migration in an actin-, microtubule- and MAP1A-dependent manner (PubMed:20543869). Also involved in neuroblastoma G1/S phase cell cycle progression and cell proliferation inhibition by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a COMMD1- and actin-dependent manner (PubMed:10564580, PubMed:28604741). May play a role in tumor development (PubMed:10564580). {ECO:0000250|UniProtKB:Q78TU8, ECO:0000269|PubMed:10564580, ECO:0000269|PubMed:20543869, ECO:0000269|PubMed:28604741}. |
| Pathway | |
| Protein Families | FAM107 family |
| Tissue Specificity | Widely expressed (PubMed:10564580). Expressed in neurons (PubMed:20543869). Expressed in malignant glial tumors (PubMed:20543869). Expression is reduced or absent in a number of cancer cell lines (PubMed:10564580). {ECO:0000269|PubMed:10564580, ECO:0000269|PubMed:20543869}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |