Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens fatty acid binding protein 6 (FABP6), transcript variant 2 (NM_001445). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P51161 |
| Entry Name | FABP6_HUMAN |
| Gene Names | FABP6 ILBP ILLBP |
| Alternative Gene Names | ILBP ILLBP |
| Alternative Protein Names | Gastrotropin (GT) (Fatty acid-binding protein 6) (Ileal lipid-binding protein) (ILBP) (Intestinal 15 kDa protein) (I-15P) (Intestinal bile acid-binding protein) (I-BABP) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 128 |
| Molecular Weight(Da) | 14371 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
Background
| Function | FUNCTION: Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes (By similarity). In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion (By similarity). {ECO:0000250|UniProtKB:P10289, ECO:0000250|UniProtKB:P51162, ECO:0000269|PubMed:12486725, ECO:0000269|PubMed:7588781}.; FUNCTION: [Isoform 2]: Essential for the survival of colon cancer cells to bile acid-induced apoptosis. {ECO:0000269|PubMed:17909007}. |
| Pathway | |
| Protein Families | Calycin superfamily, Fatty-acid binding protein (FABP) family |
| Tissue Specificity | Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level). {ECO:0000269|PubMed:17909007, ECO:0000269|PubMed:7588781, ECO:0000269|PubMed:7619861}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |