Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P15311 |
| Gene Names | EZR |
| Alternative Names | CytovillinVillin-2p81 |
| Expression Region | Partial(1-251aa ) |
| Molecular Weight | 31.4 kDa |
| Protein Sequence | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probably involved in connections of major cytoskeletal structures to the plasma mbrane. In epithelial cells, required for the formation of microvilli and mbrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis. |
| Involvement in Disease | |
| Subcellular Location | Apical cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, Cell projection, microvillus membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cell cortex, Cytoplasm, cytoskeleton |
| Protein Families | |
| Tissue Specificity | EZR |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
