Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9BSJ8 |
| Gene Names | ESYT1 |
| Alternative Names | Membrane-bound C2 domain-containing protein |
| Expression Region | Partial(1-245aa ) |
| Molecular Weight | 53.7 kDa |
| Protein Sequence | MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane. |
| Involvement in Disease | |
| Subcellular Location | Endoplasmic reticulum membrane, Multi-pass membrane protein, Cell membrane, Peripheral membrane protein |
| Protein Families | Extended synaptotagmin family |
| Tissue Specificity | ESYT1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |