Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P48664 |
Gene Names | SLC1A6 |
Alternative Names | Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6 |
Expression Region | Partial(149-271aa ) |
Molecular Weight | 40.4 kDa |
Protein Sequence | MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A6 subfamily |
Tissue Specificity | SLC1A6 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |