Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O43324 |
| Gene Names | EEF1E1 |
| Alternative Names | Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3;Elongation factor p18;Multisynthase complex auxiliary component p18 |
| Expression Region | Full Length of Mature Protein(2-174aa ) |
| Molecular Weight | 35.7 kDa |
| Protein Sequence | AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Positive modulator of ATM response to DNA damage. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Cytoplasm, cytosol, Nucleus |
| Protein Families | |
| Tissue Specificity | EEF1E1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |