Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8NBQ5 |
| Gene Names | HSD17B11 |
| Alternative Names | 17-beta-hydroxysteroid dehydrogenase 11 ;17-beta-HSD 11 ;17bHSD11 ;17betaHSD1117-beta-hydroxysteroid dehydrogenase XI ;17-beta-HSD XI ;17betaHSDXICutaneous T-cell lymphoma-associated antigen HD-CL-03 ;CTCL-associated antigen HD-CL-03Dehydrogenase/reductase SDR family member 8Retinal short-chain dehydrogenase/reductase 2 ;retSDR2Short chain dehydrogenase/reductase family 16C member 2 |
| Expression Region | Full Length of Mature Protein(20-300aa ) |
| Molecular Weight | 46.8 kDa |
| Protein Sequence | ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor-associated antigen in cutaneous T-cell lymphoma. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily |
| Tissue Specificity | HSD17B11 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |