Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% as determined by SDS-PAGE. |
Endotoxin Level | |
Biological Activity | |
Uniprot ID | Q8NBQ5 |
Gene Names | HSD17B11 |
Alternative Names | (17-beta-hydroxysteroid dehydrogenase 11)(17-beta-HSD 11)(17bHSD11)(17betaHSD11)(17-beta-hydroxysteroid dehydrogenase XI)(17-beta-HSD XI)(17betaHSDXI)(Cutaneous T-cell lymphoma-associated antigen HD-CL-03)(CTCL-associated antigen HD-CL-03)(Dehydrogenase/reductase SDR family member 8)(Retinal short-chain dehydrogenase/reductase 2)(retSDR2)(Short chain dehydrogenase/reductase family 16C member 2) |
Expression Region | 20-300aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1632 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1754℃. |
Protein Length | Full Length of Mature Protein |
Molecular Weight | 35.8 kDa |
Protein Sequence | ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ |
Background
Research Areas | Metabolism |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |