Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens ERH mRNA splicing and mitosis factor (ERH) (NM_004450). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P84090 |
| Entry Name | ERH_HUMAN |
| Gene Names | ERH |
| Alternative Gene Names | |
| Alternative Protein Names | Enhancer of rudimentary homolog |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 104 |
| Molecular Weight(Da) | 12259 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
Background
| Function | FUNCTION: May have a role in the cell cycle. |
| Pathway | |
| Protein Families | E(R) family |
| Tissue Specificity | Expressed in all tissues examined. {ECO:0000269|PubMed:8786099}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
