Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens endosulfine alpha (ENSA), transcript variant 8 (NM_207168). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O43768 |
| Entry Name | ENSA_HUMAN |
| Gene Names | ENSA |
| Alternative Gene Names | |
| Alternative Protein Names | Alpha-endosulfine (ARPP-19e) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 121 |
| Molecular Weight(Da) | 13389 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE |
Background
| Function | FUNCTION: Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-67 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase (By similarity). Also acts as a stimulator of insulin secretion by interacting with sulfonylurea receptor (ABCC8), thereby preventing sulfonylurea from binding to its receptor and reducing K(ATP) channel currents. {ECO:0000250, ECO:0000269|PubMed:9653196}. |
| Pathway | |
| Protein Families | Endosulfine family |
| Tissue Specificity | Widely expressed with high levels in skeletal muscle and brain and lower levels in the pancreas. {ECO:0000269|PubMed:14728987, ECO:0000269|PubMed:9653196}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
