Recombinant Human Enhancer of rudimentary homolog(ERH)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P84090
Gene Names ERH
Alternative Names DROER; Enhancer of rudimentary homolog (Drosophila); Enhancer of rudimentary homolog; ERH; ERH_HUMAN; FLJ27340; HGNC:3447
Expression Region Full Length of Mature Protein(2-104aa )
Molecular Weight 39.1 kDa
Protein Sequence SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May have a role in the cell cycle.
Involvement in Disease
Subcellular Location
Protein Families E(R) family
Tissue Specificity ERH
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR44h27569

Recombinant Human Enhancer of rudimentary homolog(ERH)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Enhancer of rudimentary homolog(ERH)
Copyright © 2021-present Echo Biosystems. All rights reserved.