Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P25101 |
| Gene Names | EDNRA |
| Alternative Names | Endothelin A receptor ;ET-A ;ETA-R ;hET-AR |
| Expression Region | Partial(21-80aa ) |
| Molecular Weight | 8.8 kDa |
| Protein Sequence | DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3. |
| Involvement in Disease | Mandibulofacial dysostosis with alopecia (MFDA) |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRA sub-subfamily |
| Tissue Specificity | EDNRA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |