Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 3(ERGIC3),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9Y282
Gene Names ERGIC3
Alternative Names Serologically defined breast cancer antigen NY-BR-84
Expression Region Partial(47-341aa )
Molecular Weight 49.7 kDa
Protein Sequence QYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Possible role in transport between endoplasmic reticulum and Golgi.
Involvement in Disease
Subcellular Location Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Golgi apparatus, cis-Golgi network membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERGIC family
Tissue Specificity ERGIC3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE8HU896813

Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 3(ERGIC3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 3(ERGIC3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.