Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P19957 |
| Gene Names | PI3 |
| Alternative Names | Elastase-specific inhibitor ;ESIPeptidase inhibitor 3 ;PI-3;Protease inhibitor WAP3Skin-derived antileukoproteinase ;SKALPWAP four-disulfide core domain protein 14 |
| Expression Region | Full Length of Mature Protein(61-117aa ) |
| Molecular Weight | 8 kDa |
| Protein Sequence | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | |
| Tissue Specificity | PI3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |