Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3) (NM_003732). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O60516 |
| Entry Name | 4EBP3_HUMAN |
| Gene Names | EIF4EBP3 |
| Alternative Gene Names | |
| Alternative Protein Names | Eukaryotic translation initiation factor 4E-binding protein 3 (4E-BP3) (eIF4E-binding protein 3) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 100 |
| Molecular Weight(Da) | 10873 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI |
Background
| Function | FUNCTION: Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. {ECO:0000250|UniProtKB:Q13541}. |
| Pathway | |
| Protein Families | EIF4E-binding protein family |
| Tissue Specificity | Expression is highest in skeletal muscle, heart, kidney, and pancreas, whereas there is very little expression in brain and thymus. {ECO:0000269|PubMed:9593750}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |