Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O95834 |
| Gene Names | EML2 |
| Alternative Names | 1600029N02Rik; Echinoderm microtubule associated protein like 2; Echinoderm microtubule-associated protein-like 2; Echinoderm MT associated protein like protein 70; ELP70; EMAL2_HUMAN; EMAP-2; EMAP2; EML2; HuEMAP-2 |
| Expression Region | Partial(1-418aa ) |
| Molecular Weight | 61.8 kDa |
| Protein Sequence | MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, spindle |
| Protein Families | WD repeat EMAP family |
| Tissue Specificity | EML2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
