Recombinant Human Echinoderm microtubule-associated protein-like 2(EML2),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O95834
Gene Names EML2
Alternative Names 1600029N02Rik; Echinoderm microtubule associated protein like 2; Echinoderm microtubule-associated protein-like 2; Echinoderm MT associated protein like protein 70; ELP70; EMAL2_HUMAN; EMAP-2; EMAP2; EML2; HuEMAP-2
Expression Region Partial(1-418aa )
Molecular Weight 61.8 kDa
Protein Sequence MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.
Involvement in Disease
Subcellular Location Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, spindle
Protein Families WD repeat EMAP family
Tissue Specificity EML2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE3HU7768

Recombinant Human Echinoderm microtubule-associated protein-like 2(EML2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Echinoderm microtubule-associated protein-like 2(EML2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.