Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | O43567 |
| Gene Names | RNF13 |
| Alternative Names | (RING finger protein 13)(RING-type E3 ubiquitin transferase RNF13) |
| Expression Region | 204-381aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.31 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-123℃. |
| Protein Length | Partial |
| Molecular Weight | 26.2 kDa |
| Protein Sequence | TKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINEHDVVVQLQPNGERDYNIANTV |
Background
| Research Areas | Cell Biology |
| Relevance | E3 ubiquitin-protein ligase that may play a role in controlling cell proliferation. Involved in apoptosis regulation. Mediates ER stress-induced activation of JNK signaling pathway and apoptosis by promoting ERN1 activation and splicing of XBP1 mRNA . |
| Function | |
| Reference | "Heterozygous RNF13 gain-of-function variants are associated with congenital microcephaly, epileptic encephalopathy, blindness, and failure to thrive." Edvardson S., Nicolae C.M., Noh G.J., Burton J.E., Punzi G., Shaag A., Bischetsrieder J., De Grassi A., Pierri C.L., Elpeleg O., Moldovan G.L. Am. J. Hum. Genet. 104:179-185(2019) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
